DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Karl and rbp4l

DIOPT Version :9

Sequence 1:NP_001285137.1 Gene:Karl / 32131 FlyBaseID:FBgn0030334 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001090773.1 Gene:rbp4l / 100037859 XenbaseID:XB-GENE-5839942 Length:196 Species:Xenopus tropicalis


Alignment Length:126 Identity:31/126 - (24%)
Similarity:49/126 - (38%) Gaps:36/126 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KNFDLERMMGCWHVVQYYASTEELPEYACMRSHFS--FSKEDQHITMNFSYIFAEDPLREKLVGN 122
            :|.||:|..|.|     |...::.||...::.:.|  ::.|:.      ..:.|....|.||.| 
 Frog    33 ENLDLKRYAGKW-----YGIGKKDPEGLFLQDNISADYTVEED------GTMIASSKGRVKLFG- 85

  Fly   123 ITWMI----------PKFQEPGHWQHTEDIYEGIY--------NTYVLDTDYDTWGLVMHC 165
             .|:|          |....|.....|   |:|:.        |.:|:|||||.:.:...|
 Frog    86 -FWLICAEMAAQYTVPDPSIPAKMYMT---YQGLASYLSSGGDNYWVIDTDYDNYAITYAC 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KarlNP_001285137.1 None
rbp4lNP_001090773.1 lipocalin_FABP 24..196 CDD:385686 31/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.