DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dy and CG17111

DIOPT Version :9

Sequence 1:NP_511130.2 Gene:dy / 32130 FlyBaseID:FBgn0004511 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster


Alignment Length:319 Identity:69/319 - (21%)
Similarity:116/319 - (36%) Gaps:78/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MPKIVSLDVK--CEKNGMKVFVQFDKPFNGIVFSKGHYSNMNCVHLPSGLGRSSASFDIGL---- 303
            |.::..|||:  |.::.|.:.......|.|.:::..|  :.:|:...||.|....:..||.    
  Fly   342 MRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMH--SKDCLARGSGNGSVLLTLQIGSEVKE 404

  Fly   304 HECGTAGNTDNYGQGYGHEAGSTGAGTYFENIIVIQYDPQVQEVWDQARKLRC------------ 356
            :.||..         ..:|.......|:...::|||.:|.||...|:..|:.|            
  Fly   405 NRCGIL---------RAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVS 460

  Fly   357 ------------------------TWH-------DQYEKSVTFRPFP---VDMLDVVRADFAGD- 386
                                    |.|       ..|..|....|.|   :.:||:.......| 
  Fly   461 VRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDV 525

  Fly   387 NVGCWMQIQVGKGPWASEVSGLVKIGQTMTMVLAIKDDDSKFDMLVRNCVAHDGKRAPIQLVDQR 451
            .:|..:::|:     .:|.|. .::.:.|.:.||...|.....::.:..   |.:.. :.|:|:|
  Fly   526 QIGQNLELQI-----VAEYSP-QQLAEHMELQLAPLPDFRATSLVAKTA---DNENF-VLLIDER 580

  Fly   452 GCVTRPKLMSRFTKIKNFGASASVLSYAHFQAFKFPDSMEVHFQCTIQICRYHC-PEQC 509
            ||.|...:.....::..  ||.|:|. |.|.||||..:..|.|...|:.|...| |..|
  Fly   581 GCPTDASVFPALERVHT--ASRSMLR-ARFHAFKFSGTANVSFDVKIRFCVERCSPSNC 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyNP_511130.2 ZP 254..513 CDD:214579 65/310 (21%)
Zona_pellucida <403..510 CDD:278526 30/108 (28%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.