DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dy and CG10005

DIOPT Version :9

Sequence 1:NP_511130.2 Gene:dy / 32130 FlyBaseID:FBgn0004511 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster


Alignment Length:209 Identity:50/209 - (23%)
Similarity:75/209 - (35%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LQLQVQPQQQQQQQQQHTQQQGQQQQVQVPDLSVGGSSNNEIWAAPVQDMPKIVSLD-------V 253
            |.|.|.....:||:.|                      |.|||...:.|..||...|       :
  Fly    16 LLLAVHVSANKQQKNQ----------------------NQEIWEQDLSDTFKIEGSDQGIQKVNL 58

  Fly   254 KCEKNGMKVFVQFDKPFNGIVFSKGHYSNMN--CVHLP-SGLGRSSASFDIGLHECGTAGNTDNY 315
            ||..:.|.|.::.:|||.|:::::|.:...:  |...| |..|..:...:..|.:|.|..:.|.|
  Fly    59 KCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEMNFQLDQCQTIRDGDLY 123

  Fly   316 GQGYGHEAGSTGAGTYFENIIVIQYDPQVQEVWDQARKLRCTWHDQYEKSVTFRPFPVDMLDVVR 380
                             .||:|||.||::....|.|..|.|.:.....            |||..
  Fly   124 -----------------TNIVVIQNDPELITPGDSAFSLECDFRQPRN------------LDVEA 159

  Fly   381 ADFAGDNVGCWMQI 394
            :..|.|.|....:|
  Fly   160 SMQARDRVATGSKI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyNP_511130.2 ZP 254..513 CDD:214579 36/144 (25%)
Zona_pellucida <403..510 CDD:278526
CG10005NP_650137.3 ZP 59..>162 CDD:214579 32/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.