DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dy and cutl-15

DIOPT Version :9

Sequence 1:NP_511130.2 Gene:dy / 32130 FlyBaseID:FBgn0004511 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_495904.2 Gene:cutl-15 / 174426 WormBaseID:WBGene00011888 Length:385 Species:Caenorhabditis elegans


Alignment Length:294 Identity:56/294 - (19%)
Similarity:96/294 - (32%) Gaps:103/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GTYFENIIVIQYDPQVQEVWDQARKLRCTWHDQYEKSVTF------RPFPVDMLDVVRADFAGDN 387
            |...|..:.:.:.|:...|.|:...::|....:...:.|.      :|.|.|.            
 Worm   101 GVILEVSLSVSFHPEFTTVDDRIFNMQCFHQKKINGTSTSLAIGSPKPPPSDT------------ 153

  Fly   388 VGCWMQIQVGKGPWAS-EVSGLVKIGQTMTMVLAIKDD-------DSKFD--MLVRNCVAHDGKR 442
                      |||..| ||  |...|......||:..|       .:.::  :::.||....|:.
 Worm   154 ----------KGPSCSYEV--LTSPGGLPAGRLALGQDVYHSWQCQNVYESCIMIENCELVGGEE 206

  Fly   443 APIQLVDQRGCVTRPKLMSRF---------TKIKNFGASASVLSYAHFQAFKFPDSMEVHFQCTI 498
            .. :::|..||.....:|.:.         |.:|.||.|.:.:               |:|.|.:
 Worm   207 TH-EVIDSSGCSKHESIMPQLEYHNRTHVGTSVKVFGVSHTSI---------------VYFACQV 255

  Fly   499 ----QICRYHCPE-QC--------------SAETNLQDVHHLQV----------GPESQYGPP-- 532
                |:....||: :|              |.:...|::...|:          .|..   ||  
 Worm   256 RLHPQLPTGECPKPKCDLMRRKREDSSQFPSIDVRSQNLEISQLINITSSTMTPHPTE---PPIQ 317

  Fly   533 ---PQLHVDAYHVASAI-GKRRDERRVQRRARAV 562
               |.:||:...:..|. .|..||.|:....|:|
 Worm   318 HTCPDIHVETESIEEASESKALDEERICADFRSV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyNP_511130.2 ZP 254..513 CDD:214579 41/227 (18%)
Zona_pellucida <403..510 CDD:278526 27/144 (19%)
cutl-15NP_495904.2 ZP 41..272 CDD:214579 39/210 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3981
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.