Sequence 1: | NP_572746.1 | Gene: | CG9360 / 32128 | FlyBaseID: | FBgn0030332 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003699.3 | Gene: | RDH16 / 8608 | HGNCID: | 29674 | Length: | 317 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 62/207 - (29%) |
---|---|---|---|
Similarity: | 90/207 - (43%) | Gaps: | 23/207 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQE 70
Fly 71 VIDAFAWI-----DATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130
Fly 131 SLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSIS 195
Fly 196 PGAVDTEIIDKE 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9360 | NP_572746.1 | YdfG | 1..250 | CDD:226674 | 62/207 (30%) |
NADB_Rossmann | 1..246 | CDD:304358 | 62/207 (30%) | ||
RDH16 | NP_003699.3 | NADB_Rossmann | 30..305 | CDD:304358 | 62/206 (30%) |
adh_short | 30..218 | CDD:278532 | 62/206 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1880 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |