DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and RDH16

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_003699.3 Gene:RDH16 / 8608 HGNCID:29674 Length:317 Species:Homo sapiens


Alignment Length:207 Identity:62/207 - (29%)
Similarity:90/207 - (43%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQE 70
            ::...:||..||.|....:.|.::||.|:.....|...::|:    ...:.|......||::.:.
Human    29 DKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLR----GQTSDRLETVTLDVTKTES 89

  Fly    71 VIDAFAWI-----DATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130
            |..|..|:     |..|.|   ||||||| .|...........|...|||.|:|||...|.....
Human    90 VAAAAQWVKECVRDKGLWG---LVNNAGI-SLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLP 150

  Fly   131 SLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSIS 195
            .::|..   |.::.|:||.| ||    .:..|.|..|||.|.|.::.||:|.  :....|:..|.
Human   151 LVRRAR---GRVVNVSSVMG-RV----SLFGGGYCISKYGVEAFSDSLRREL--SYFGVKVAMIE 205

  Fly   196 PGAVDTEIIDKE 207
            ||...|.:..||
Human   206 PGYFKTAVTSKE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 62/207 (30%)
NADB_Rossmann 1..246 CDD:304358 62/207 (30%)
RDH16NP_003699.3 NADB_Rossmann 30..305 CDD:304358 62/206 (30%)
adh_short 30..218 CDD:278532 62/206 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.