DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and YMR226C

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:77/263 - (29%)
Similarity:129/263 - (49%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DRWLNRVAVVTGASSGIGAACCKDLV--SKG-LVVVGLARREDRLQELKASLPADQA---SRFHG 60
            :|...:..::||||:|||.|...:.:  |.| :.::..|||.::|:|||.::  ||.   ::.|.
Yeast     9 ERLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTI--DQEFPNAKVHV 71

  Fly    61 RKCDVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGA--DLRAILDTNVLGVSW 123
            .:.|::|.:::......:.......|:||||||   ..:|....|..|  |::.:.||||..:..
Yeast    72 AQLDITQAEKIKPFIENLPQEFKDIDILVNNAG---KALGSDRVGQIATEDIQDVFDTNVTALIN 133

  Fly   124 CTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQ 188
            .|:......:.:  |.|.|:.:.|:||.....    |..:|..||:||.|.|:.||:|..|  |:
Yeast   134 ITQAVLPIFQAK--NSGDIVNLGSIAGRDAYP----TGSIYCASKFAVGAFTDSLRKELIN--TK 190

  Fly   189 TKITSISPGAVDTEII-------DKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIHELTIKP 246
            .::..|:||.|:||..       :::|.....|...|.::||||.|.|......|..|.:..|.|
Yeast   191 IRVILIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYATSRKQNTVIADTLIFP 255

  Fly   247 VGE 249
            ..:
Yeast   256 TNQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 77/263 (29%)
NADB_Rossmann 1..246 CDD:304358 76/258 (29%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 76/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.