DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and AT1G10310

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_563866.1 Gene:AT1G10310 / 837570 AraportID:AT1G10310 Length:242 Species:Arabidopsis thaliana


Alignment Length:214 Identity:57/214 - (26%)
Similarity:97/214 - (45%) Gaps:19/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFH-GRKCDVSQEQE 70
            |..::||.|.|:|.|...:|..:|..|:|.||.:::|..|::.|   .:|..| ....||.....
plant    18 RTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSEL---SSSTNHLLLTADVKSNSS 79

  Fly    71 VIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRR 135
            |.:....|....|..|::|||||.:.....| .|.:..|...::||||.||:...|.....:..|
plant    80 VEEMAHTIVEKKGVPDIIVNNAGTINKNSKI-WEVSAEDFDNVMDTNVKGVANVLRHFIPLMLPR 143

  Fly   136 NVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAVD 200
            ...    :|||..:|..  .:....:..|..||:|:..|:..:.:|......   :.:::||.::
plant   144 KQG----IIVNMSSGWG--RSGAALVAPYCASKWAIEGLSRAVAKEVVEGMA---VVALNPGVIN 199

  Fly   201 TEII-----DKEALVGIPD 214
            ||::     :..:|...||
plant   200 TELLTSCFGNSASLYQAPD 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 57/214 (27%)
NADB_Rossmann 1..246 CDD:304358 57/214 (27%)
AT1G10310NP_563866.1 SDR_c 20..>205 CDD:212491 53/197 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.