DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and NOL

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_568145.1 Gene:NOL / 830372 AraportID:AT5G04900 Length:348 Species:Arabidopsis thaliana


Alignment Length:196 Identity:53/196 - (27%)
Similarity:93/196 - (47%) Gaps:5/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQEVIDA 74
            ::||::.|||.|..::.:..|..||..:|..:|::....||..:......|.||||::.::|.:.
plant    83 LITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEEFGEHVWGTKCDVTEGKDVREL 147

  Fly    75 FAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRRNVND 139
            .|:....|...|:.:||||..........|.:..||..::.||.||:..|.|||...:..:: ..
plant   148 VAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAMNMMLTQS-RG 211

  Fly   140 GHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKIT-SISPGAVDTEI 203
            |||..::.....   ..|......|..:|.:|..||:.|:.|......:..:. ::|||.|.|::
plant   212 GHIFNIDGAGSD---GRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVTTDL 273

  Fly   204 I 204
            :
plant   274 L 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 53/196 (27%)
NADB_Rossmann 1..246 CDD:304358 53/196 (27%)
NOLNP_568145.1 adh_short 81..276 CDD:278532 53/196 (27%)
SDR_c 82..302 CDD:212491 53/196 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.