DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and NYC1

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:287 Identity:70/287 - (24%)
Similarity:120/287 - (41%) Gaps:76/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARRED----RLQELKASLP-----ADQASR----- 57
            |..|:||::.|:|.|..::.:..|..|:..:|..:    .::||:.:|.     |.:::|     
plant   162 RNVVITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKKLSD 226

  Fly    58 --FHGRKCDVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEG-------NGADLRAI 113
              ..|..|||.:.::|.....:....||..::.:||||        |::|       ...|:..|
plant   227 AKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAG--------TNKGFRPLLEFTEEDITQI 283

  Fly   114 LDTNVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVL 178
            :.||::|...|||.|...:.|:: :.|||           .|..|...|..|....||...|:..
plant   284 VSTNLIGSILCTRGAMDVMSRQH-SGGHI-----------FNMDGAGSGGSSTPLTAVYGSTKCG 336

  Fly   179 RQEFH------NNKTQTKITSISPGAVDTEII-------DKEALVGIPDFPMLRSEDVA------ 224
            .::||      :.||...:.:.|||.|.||::       :|:....|.:.|    |.||      
plant   337 LRQFHGSIVKESQKTNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELP----ETVARTLVPR 397

  Fly   225 --------DAISYCIQTPPNVQIHELT 243
                    .|::|.  |||.:.:..:|
plant   398 MRVVKGSGKAVNYL--TPPRILLAIVT 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 70/287 (24%)
NADB_Rossmann 1..246 CDD:304358 70/287 (24%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.