DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and dhrs7

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001038811.1 Gene:dhrs7 / 751626 ZFINID:ZDB-GENE-060825-21 Length:338 Species:Danio rerio


Alignment Length:219 Identity:63/219 - (28%)
Similarity:98/219 - (44%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELK------ASLPA-----------DQ 54
            :|..:||||||||......|.:.|..:|..||||:.|:.:|      :||.|           |:
Zfish    50 KVVWITGASSGIGEELSLQLAAIGARLVLSARRENELERVKRLCLERSSLKAEDILVLPLDLMDR 114

  Fly    55 ASRFHGRKCDVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADL---RAILDT 116
            ||  |..|...:.|.            .|..|||:||.|..:..:.:     .||:   :|:::.
Zfish   115 AS--HPEKTTAALEH------------FGEIDVLINNGGRSQRALCV-----DADVDVYQALMEL 160

  Fly   117 NVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGM-YSPSKYAVTALTEVLRQ 180
            |.||....|::....:.:|..  |.|..|:||||.     .|:.:.. |:.||:|:......||.
Zfish   161 NYLGTVSITKQVLPHMIQRGT--GIIATVSSVAGF-----VGVPLATGYAASKHALQGFFNSLRT 218

  Fly   181 EFHNNKTQTKITSISPGAVDTEII 204
            |. ::.....|::|.||.|.:.|:
Zfish   219 EL-SDCPNILISNICPGPVISSIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 63/219 (29%)
NADB_Rossmann 1..246 CDD:304358 63/219 (29%)
dhrs7NP_001038811.1 11beta-HSD1_like_SDR_c 47..307 CDD:187593 63/219 (29%)
adh_short 50..249 CDD:278532 63/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.