DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Rdh8

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001162065.1 Gene:Rdh8 / 690953 RGDID:1589829 Length:312 Species:Rattus norvegicus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:116/281 - (41%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKDLV---SKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQEV 71
            :::|.|||||......|.   .:...||...|...:.:.|:|:............:.||..::.|
  Rat     9 LISGCSSGIGLELAVQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVAQLDVCSDESV 73

  Fly    72 IDAFAWIDATLGGADVLVNNAGIVRLG-VGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRR 135
            .:..:.|:.  |..|:||||||:   | ||...:.:.|.::.:.:||..|.....:.....:|||
  Rat    74 TNCLSHIEG--GQVDILVNNAGV---GLVGPLEDLSLATMQNVFNTNFFGAVRLVKAVLPGMKRR 133

  Fly   136 NVNDGHILIVNSVAGHRVINNPGITMG-MYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAV 199
              ..|||::|:||.|.:     |:... :|:.||:|:....|.|..:.  .:....|:.:.||.|
  Rat   134 --RQGHIVVVSSVMGLQ-----GVMFNDVYAASKFALEGFFESLAIQL--RQFNIFISMVEPGPV 189

  Fly   200 DTEIIDK-EALVGIPDFP--------------------MLRS-----EDVADAISYCIQT--PP- 235
            .|:...| .|.|...:||                    :.||     .|||..|:..|.:  || 
  Rat   190 ITDFEGKLLAQVSKTEFPDTDPETLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGSTRPPL 254

  Fly   236 ----NVQIHELT----IKPVG 248
                |.:...||    :.|.|
  Rat   255 RRQTNARYFPLTALKALDPSG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 72/281 (26%)
NADB_Rossmann 1..246 CDD:304358 70/277 (25%)
Rdh8NP_001162065.1 NADB_Rossmann 8..262 CDD:304358 68/266 (26%)
adh_short 8..201 CDD:278532 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.