DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Dhrs7c

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001013031.2 Gene:Dhrs7c / 68460 MGIID:1915710 Length:311 Species:Mus musculus


Alignment Length:203 Identity:54/203 - (26%)
Similarity:92/203 - (45%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLP--ADQASRFHGR------- 61
            |:|.|:|.|.||:|..|.:...:.|..:|...:..:.|:.|.|:|.  ||.:..|..:       
Mouse    37 NKVVVITDAISGLGKECARVFHAGGARLVLCGKNWEGLESLYATLTSVADPSKTFTPKLVLLDLS 101

  Fly    62 --KCDVSQEQEVIDAFAWIDATLGGADVLVNNAGI-VRLGVGITHEGNGADLRAILDTNVLGVSW 123
              .|.....:||:|.:       |..|:|:|||.: |:   |..|:.:....:.|:|.|..|...
Mouse   102 DISCVQDVAKEVLDCY-------GCVDILINNASVKVK---GPAHKISLELDKKIMDANYFGPIT 156

  Fly   124 CTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQ 188
            .|:....::..|..  |.|::||::.....|  |..|  .|:.||:||....:.||.|.  .:..
Mouse   157 LTKVLLPNMISRRT--GQIVLVNNIQAKFGI--PFRT--AYAASKHAVMGFFDCLRAEV--EEYD 213

  Fly   189 TKITSISP 196
            ..::::||
Mouse   214 VVVSTVSP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 54/203 (27%)
NADB_Rossmann 1..246 CDD:304358 54/203 (27%)
Dhrs7cNP_001013031.2 11beta-HSD1_like_SDR_c 35..296 CDD:187593 54/203 (27%)
PRK06181 37..293 CDD:235726 54/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.