DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and rdh7

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001017189.1 Gene:rdh7 / 549943 XenbaseID:XB-GENE-1194363 Length:318 Species:Xenopus tropicalis


Alignment Length:271 Identity:65/271 - (23%)
Similarity:106/271 - (39%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQE 70
            ::..::||..||.|....:.|..:|:.|:.....:...|:||    .:.:||......||:..:.
 Frog    29 DKYVLITGCDSGFGNLLARQLDKRGIHVLAACLTDKGAQDLK----KETSSRLQTVILDVTDSKS 89

  Fly    71 VIDAFAWIDATLGGADV--LVNNAGIVRLGVGITHEGN----GADLRAILDTNVLGVSWCTREAF 129
            |.....|:.:.:|...:  |||||     ||.:....|    ..|...||:.|:|||...|.:..
 Frog    90 VCSVANWVSSIVGNKGLWGLVNNA-----GVSVPSAPNEWLTKEDFLKILNVNLLGVIDVTIKLL 149

  Fly   130 KSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSI 194
            ..:::..   |.::.|.|:||.......|     |..|||.|.:.::.||.|.  .....|:..:
 Frog   150 PQVRKAK---GRVVNVASIAGRLTFCGGG-----YCMSKYGVESFSDSLRHEM--APFGVKVCMV 204

  Fly   195 SPGAVDTEIID----KEALV----GIP-------------------DFPMLRSEDVADAISYCIQ 232
            .||...|::.|    ||.|.    |:|                   |..:.||......::.|::
 Frog   205 EPGFFKTQVTDARLQKEHLQKIWHGLPEEIRKSYGQQYYDKYCSNVDLSLARSNPKLHLVTDCME 269

  Fly   233 TPPNVQIHELT 243
                   |.||
 Frog   270 -------HALT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 65/271 (24%)
NADB_Rossmann 1..246 CDD:304358 65/271 (24%)
rdh7NP_001017189.1 NADB_Rossmann 30..306 CDD:304358 65/270 (24%)
adh_short 30..221 CDD:278532 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.