DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and RDH8

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:277 Identity:75/277 - (27%)
Similarity:108/277 - (38%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLV---SKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQE 68
            |..:::|.|||||......|.   .|...||...|...:.:.|:|:............:.||..:
Human     6 RTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSD 70

  Fly    69 QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRA---ILDTNVLGVSWCTREAFK 130
            :.|....:.|.   |..|||||||     |:|:.....|..|.|   :.|||..|.....:....
Human    71 ESVAQCLSCIQ---GEVDVLVNNA-----GMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLP 127

  Fly   131 SLKRRNVNDGHILIVNSVAG-HRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSI 194
            .:|||  ..|||::::||.| ..||.|     .:|:.||:|:....|.|..:.  .:....|:.:
Human   128 GMKRR--RQGHIVVISSVMGLQGVIFN-----DVYAASKFALEGFFESLAIQL--LQFNIFISLV 183

  Fly   195 SPGAVDTEIIDK-EALVGIPDFPMLRSE-------------------------DVADAISYCIQT 233
            .||.|.||...| .|.|.:.:||....|                         ||..||...|.:
Human   184 EPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISS 248

  Fly   234 --PP-----NVQIHELT 243
              ||     |::...||
Human   249 TRPPLRRQTNIRYSPLT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 75/277 (27%)
NADB_Rossmann 1..246 CDD:304358 75/277 (27%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 73/272 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.