DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG7601

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:259 Identity:69/259 - (26%)
Similarity:113/259 - (43%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPA---DQASRFHGRKCDVSQE 68
            :|.::||||||:|.:........|..|:..|||...|:.:|..|.|   |.|........|:::.
  Fly    54 KVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLDLAEL 118

  Fly    69 QEVIDAFAWIDATLGGADVLVNNAGI-VRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSL 132
            ..:.:....:.|.....|:|:||.|| ||..|..|  ....||: ::..|..|....|:....|:
  Fly   119 NSIPEFVTRVLAVYNQVDILINNGGISVRADVAST--AVDVDLK-VMVVNYFGSVALTKALLPSM 180

  Fly   133 KRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPG 197
            .:|  ..|||..::||.|...|..    ...||.||:|:.|..:.||.|..|.  ...::.:|||
  Fly   181 VKR--GSGHICFISSVQGKFAIPQ----RAAYSASKHAMQAFADSLRAEVANK--NINVSCVSPG 237

  Fly   198 AVDTEI--------------IDKEALVGI-PDFPMLRSEDVADAISYCI-QTPPNVQIHELTIK 245
            .:.|::              :|:....|: ||       .:|:.|..|| :..|::.:.::..|
  Fly   238 YIRTQLSLNALTGSGSSYGKVDETTAKGMSPD-------KLAERILQCILRKEPDIIVSDVQAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 69/259 (27%)
NADB_Rossmann 1..246 CDD:304358 69/259 (27%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 69/259 (27%)
PRK06181 53..314 CDD:235726 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.