DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Hsdl2

DIOPT Version :10

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:244 Identity:62/244 - (25%)
Similarity:101/244 - (41%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASL--PADQASRFHGR--KC--DV 65
            |...:||||.|||..........|..:|..|:..:...:|..::  .|::..:..|:  .|  ||
  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVVDV 74

  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130
            ..||:|..|.....|..||.|:::|||..:.|......:....||  :.:.|..|....::....
  Fly    75 RDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDL--MHNINTRGTFLVSKVCLP 137

  Fly   131 SLKRRNVNDGHILIVNSVAGHRVINNPGITMG--------MYSPSKYAVTALTEVLRQEFHNNKT 187
            .||:.  |..|||.:          :|.::|.        .|:.:||.::.....:..||.:.  
  Fly   138 YLKKS--NHAHILNI----------SPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDE-- 188

  Fly   188 QTKITSISP-GAVDTEIIDKEALVGIPDFP--MLRSEDVADAISYCIQT 233
            ...:.::.| .|:.|..|  |.|.| ||..  ..:.|.:||| :|.|.|
  Fly   189 GISVNALWPRTAIHTAAI--EMLTG-PDSAKWSRKPEIMADA-AYAILT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 Rossmann-fold NAD(P)(+)-binding proteins 1..246 CDD:473865 62/244 (25%)
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349 62/244 (25%)
SCP2 306..408 CDD:442486
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.