DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG3301

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster


Alignment Length:249 Identity:173/249 - (69%)
Similarity:204/249 - (81%) Gaps:1/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDV 65
            |:|||||||||||||:|||||||:|||:||:|||||||||..||::|:|||||||:|||.|.|||
  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDV 65

  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130
            |.||:|||.|||||.||||||||||||||:| .:.||...|.||:|||||.|||||:||||:.|.
  Fly    66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIR-QMNITDPENSADVRAILDVNVLGVTWCTRQWFL 129

  Fly   131 SLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSIS 195
            ||:||.|||||::::|||.||.|....|.::.||:|||:|:|||||:|||||....|||||||||
  Fly   130 SLQRRKVNDGHVVVINSVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSIS 194

  Fly   196 PGAVDTEIIDKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIHELTIKPVGE 249
            ||.|.|||.:..:.......|||||||:|||::|||||||.|||.||.||||||
  Fly   195 PGVVATEIFEAGSWEQPTGMPMLRSEDIADAVTYCIQTPPTVQIKELIIKPVGE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 173/249 (69%)
NADB_Rossmann 1..246 CDD:304358 168/244 (69%)
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 173/249 (69%)
NADB_Rossmann 1..245 CDD:304358 168/244 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442640
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1110.900

Return to query results.
Submit another query.