DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG31546

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:208 Identity:55/208 - (26%)
Similarity:90/208 - (43%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDR--LQELKASLPADQASRFHGRKCDVSQEQ 69
            :|.::|||:||||||.. ::.||....:.|..||:.  :..:|..:......  :|...|:.:..
  Fly    14 KVVLITGAASGIGAAAA-EMFSKLGACLALVDREEEGLICVMKRCMKMGHEP--YGIAGDLLKPP 75

  Fly    70 EVIDAFA--WIDATLGGADVLVNNAGIVRLG-------VGITHEGNGADLRAILDTNVLGVSWCT 125
            | |:..|  ..:...|..|||||.|||:..|       ...||         :::.||....:.|
  Fly    76 E-IECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTH---------VMEANVRSGFYLT 130

  Fly   126 REAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTK 190
            :.....|.:..   |.|:.|:||.|.|...|    :..|:.||.||...|..|..:.  .....:
  Fly   131 KLLLPQLLQCK---GSIVNVSSVCGLRAFPN----LVAYNMSKAAVDQFTRSLALDL--GPQGVR 186

  Fly   191 ITSISPGAVDTEI 203
            :.:::||.:.|.:
  Fly   187 VNAVNPGVIRTNL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 55/208 (26%)
NADB_Rossmann 1..246 CDD:304358 55/208 (26%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 55/208 (26%)
NADB_Rossmann 11..261 CDD:304358 55/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.