DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG12171

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:258 Identity:79/258 - (30%)
Similarity:118/258 - (45%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKG--LVVVGLARREDRLQELKASL------PADQASR 57
            |..:.::|.:||||||||||.....|...|  |.:||  |..|:|.|....:      ||.|.: 
  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVG--RNLDKLNETAEQIVAAGGAPALQVA- 62

  Fly    58 FHGRKCDVSQEQEVIDAFAWIDATL---GGADVLVNNAGIVRLGVGITHEGNGAD-LRAILDTNV 118
                 .|::.|.:|...   :.|||   |..|||||||||:.||   :.|....: ...:::|||
  Fly    63 -----ADINSESDVQGI---VSATLAKHGRIDVLVNNAGILELG---SIENTSLEQFDRVMNTNV 116

  Fly   119 LGVSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFH 183
            ..:...|......|.:   ..|:|:.|:||.|.|  :.||:.  .|:.||.||...|..:..|. 
  Fly   117 RSLYQLTHLVTPELIK---TKGNIVNVSSVNGIR--SFPGVL--AYNVSKAAVDQFTRCVALEL- 173

  Fly   184 NNKTQTKITSISPGAVDTEI-----IDKEALV------------GIPDFPMLRSEDVADAISY 229
             .....::.|::||.:.||:     :|:||.|            |.|.    ..::||.||::
  Fly   174 -APKGVRVNSVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPG----EVKEVAAAIAF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 79/258 (31%)
NADB_Rossmann 1..246 CDD:304358 79/258 (31%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/257 (30%)
NADB_Rossmann 4..254 CDD:304358 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.