DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG31549

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:218 Identity:70/218 - (32%)
Similarity:110/218 - (50%) Gaps:28/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKG--LVVVGLARREDRLQELKASLPADQASRFHGRKC 63
            |..:.::|.:||||||||||:....|...|  ||:||  |.|::|:|...::.|...:.....:.
  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVG--RNEEKLKETADNIVAAGGATPLELQA 63

  Fly    64 DVSQEQEVIDAFAWIDATL---GGADVLVNNAGIVRLGVGITHEGNGAD-LRAILDTNVLGVSWC 124
            |:::|.||...   :.|||   |..|||||||||:..|   :.|....: ...:::|||..:...
  Fly    64 DMTKEAEVQQI---VGATLAKHGRIDVLVNNAGILETG---SIEATSLEQFDRLMNTNVRSLYQL 122

  Fly   125 TREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQT 189
            |..|...|.:   ..|:|:.|:||.|.|..  ||:.  .|:.||.||...|..:..|.  .....
  Fly   123 TMLATPELVK---TKGNIVNVSSVCGLRAF--PGVL--AYNVSKAAVDQFTACIALEL--APKGV 178

  Fly   190 KITSISPGAVDTEI-----IDKE 207
            ::.:::||.:.|:|     :|:|
  Fly   179 RVNAVNPGVIVTDIHKRGGMDEE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 70/218 (32%)
NADB_Rossmann 1..246 CDD:304358 70/218 (32%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 69/215 (32%)
fabG 4..251 CDD:235975 69/215 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.