DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and hsd17b1

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_991147.2 Gene:hsd17b1 / 402842 ZFINID:ZDB-GENE-040901-5 Length:293 Species:Danio rerio


Alignment Length:205 Identity:60/205 - (29%)
Similarity:96/205 - (46%) Gaps:23/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVS---KGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQE 68
            :|.::||.|||||.:....|.|   |...|....|..|:.|.|..|:...........:.||:.:
Zfish     4 KVVLITGCSSGIGLSLAVHLASNPAKAYKVYATMRNLDKKQRLLESVRGLHKDTLDILQMDVTDQ 68

  Fly    69 QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLK 133
            |.::||..  :.:.|..|:||.|||:..:|...||..:  .:|||||.|:||.....:.....:|
Zfish    69 QSILDAQR--NVSEGRIDILVCNAGVGLMGPLETHSLD--TIRAILDVNLLGTIRTIQTFLPDMK 129

  Fly   134 RRNVNDGHILIVNSVAGHRVINNPGITMG-MYSPSKYAVTALTE---VLRQEFHNNKTQTKITSI 194
            ::  ..|.||:..|:.|.:     |:... :|..||:|:....|   :|.|.|:     ..|:.|
Zfish   130 KK--RHGRILVTGSMGGLQ-----GLPFNEVYCASKFAIEGACESLAILLQHFN-----IHISLI 182

  Fly   195 SPGAVDTEII 204
            ..|.|:|:.:
Zfish   183 ECGPVNTDFL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 60/205 (29%)
NADB_Rossmann 1..246 CDD:304358 60/205 (29%)
hsd17b1NP_991147.2 SDR 4..257 CDD:330230 60/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.