Sequence 1: | NP_572746.1 | Gene: | CG9360 / 32128 | FlyBaseID: | FBgn0030332 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991147.2 | Gene: | hsd17b1 / 402842 | ZFINID: | ZDB-GENE-040901-5 | Length: | 293 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 60/205 - (29%) |
---|---|---|---|
Similarity: | 96/205 - (46%) | Gaps: | 23/205 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVVTGASSGIGAACCKDLVS---KGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQE 68
Fly 69 QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLK 133
Fly 134 RRNVNDGHILIVNSVAGHRVINNPGITMG-MYSPSKYAVTALTE---VLRQEFHNNKTQTKITSI 194
Fly 195 SPGAVDTEII 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9360 | NP_572746.1 | YdfG | 1..250 | CDD:226674 | 60/205 (29%) |
NADB_Rossmann | 1..246 | CDD:304358 | 60/205 (29%) | ||
hsd17b1 | NP_991147.2 | SDR | 4..257 | CDD:330230 | 60/205 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |