DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG8757

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:125/254 - (49%)
Similarity:186/254 - (73%) Gaps:9/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDV 65
            |:||.|:||||:|||:||||||.:.|:..|::|||||||.:|:::|::.|..:|.||.|..|||:
  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDI 65

  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVG-ITHEGNGADLRAILDTNVLGVSWCTREAF 129
            :||.:|:.||.|....|||.||||:||||:  |.| ::...:|..:|:.::||::|..:|.||:|
  Fly    66 TQEDQVLKAFDWTCRQLGGVDVLVSNAGII--GTGELSERDDGPAMRSTIETNIMGTVYCVRESF 128

  Fly   130 KSLKRRNVNDGHILIVNSVAGHRVIN-NPGI-TMGMYSPSKYAVTALTEVLRQEFHNNKTQTKIT 192
            :|:|||. .:||::|||||||::|.| .|.: ::.:|..:|:|:.|:.|:.||||..:||..:::
  Fly   129 RSMKRRG-TEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVS 192

  Fly   193 SISPGAVDTEIIDKEALVGI--PDFPMLRSEDVADAISYCIQTPPNVQIHELTIKPVGE 249
            ::|||.|||.|: .|.:.||  ...|||||:|||||:.:.|.||||||:|.:||||.||
  Fly   193 TVSPGIVDTVIL-PEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITIKPQGE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 125/254 (49%)
NADB_Rossmann 1..246 CDD:304358 121/249 (49%)
CG8757NP_648664.2 YdfG 1..252 CDD:226674 125/254 (49%)
NADB_Rossmann 1..247 CDD:304358 121/249 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442645
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1211.860

Return to query results.
Submit another query.