DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:208 Identity:53/208 - (25%)
Similarity:93/208 - (44%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKAS-----------LPADQASRFHGRKC 63
            :|||||:|||..........|..:|..|||.:.|:::.:.           :|||.|:       
Zfish    37 LVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQVVSKCREMGAQKAFYIPADMAN------- 94

  Fly    64 DVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGIT----HEGNGADLRAILDTNVLGVSWC 124
              ..:.:::..:| |: .|||.|.||.|      .:|.:    .:|:....|.:|:.|.|.....
Zfish    95 --PSDADLVVKYA-IE-QLGGLDYLVLN------HIGPSPYQMWDGDVQHTRWLLEVNFLSYLQM 149

  Fly   125 TREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQT 189
            .::|..:|::   :.|.|::|:|:.|.  |..|...  .|:.:|:|:......|:.|....|:..
Zfish   150 AQKALPTLEK---SKGSIVVVSSLLGK--ICGPFAL--PYASTKFALNGFFGGLQNELAMQKSNV 207

  Fly   190 KITSISPGAVDTE 202
            .||....|.:||:
Zfish   208 SITICILGLIDTD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 53/208 (25%)
NADB_Rossmann 1..246 CDD:304358 53/208 (25%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 53/208 (25%)
adh_short 36..229 CDD:278532 53/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.