DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG10672

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:247 Identity:66/247 - (26%)
Similarity:109/247 - (44%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDV 65
            |.|...:|||||.::.|||.|..|.|...|..||..:|::..:....|.|.....: .||.||.|
  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLN-VHGLKCHV 129

  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRA-------ILDTNVLGVSW 123
            |:.::....|....:..|..::||:||.        |:...|..|..       |.|.||.....
  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNAA--------TNPAVGGVLECDEKVWDKIFDVNVKSSYL 186

  Fly   124 CTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQ 188
            ..:||...|:::  .:..|:.|:|:||:....    .:|.||.||.|:..||:...::.  ....
  Fly   187 LAKEALPLLRQQ--KNSSIVFVSSIAGYDAFE----LLGAYSVSKTALIGLTKAAAKDL--APEG 243

  Fly   189 TKITSISPGAVDT---------EIIDKEALVGIPDFPMLRSEDVADAISYCI 231
            .::..::||.:.|         |..::.||..||...:..||::|..:|:.:
  Fly   244 IRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 66/247 (27%)
NADB_Rossmann 1..246 CDD:304358 66/247 (27%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 65/246 (26%)
fabG 67..316 CDD:235975 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.