DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and dhs-6

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:271 Identity:58/271 - (21%)
Similarity:95/271 - (35%) Gaps:61/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASL--PADQASRFHGR--KC 63
            :::.|..::||||.|||......|...|..:|..|:......:|..::  .|::..:..|:  .|
 Worm     6 KFVGRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKALPC 70

  Fly    64 --DVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTR 126
              ||..|..|..:........||.|:|:|||..:.|......|....||...::|.  |....|:
 Worm    71 IVDVRDEASVKASVEEAVKKFGGIDILINNASAISLTDTENTEMKRYDLMHSINTR--GTFLMTK 133

  Fly   127 EAFKSLKRRNVNDGHIL------------IVNSVA--------------GHRVINNPGITMGMYS 165
            .....||  :..:.|:|            ..|.||              .|......||.:....
 Worm   134 TCLPYLK--SGKNPHVLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHEEFRPHGIAVNALW 196

  Fly   166 PSKYAVTALTEVLRQEFHNNKTQTKITSISPGA-----------------VDTEIIDKEALVG-- 211
            |.....||..|:|..:  ..:..::..||...|                 :|.:|:..|.:..  
 Worm   197 PLTAIWTAAMEMLSDK--GGEAGSRKPSIMADAAYAVLSKNSKDFTGNFCIDEDILKAEGVTDFD 259

  Fly   212 ----IPDFPML 218
                :||.|::
 Worm   260 RYACVPDAPLM 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 58/271 (21%)
NADB_Rossmann 1..246 CDD:304358 58/271 (21%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 58/268 (22%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.