DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and ZK697.14

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001024318.1 Gene:ZK697.14 / 3565013 WormBaseID:WBGene00022809 Length:249 Species:Caenorhabditis elegans


Alignment Length:217 Identity:55/217 - (25%)
Similarity:95/217 - (43%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKD-LVSKGL-VVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQ 69
            |..::|||:.|||....|. |.::|: :|:...|...:..||.:.  ||  ||......::..:.
 Worm     4 RSILITGANRGIGLGLVKQFLKNEGIQLVIATCRNPSKADELNSI--AD--SRLQIFPLEIDCDD 64

  Fly    70 EVIDAFAWIDATLG--GADVLVNNAGIVRLGVGITHEGNG----ADLRAILDTNVLGVSWCTREA 128
            .:...:..:|..:|  |..||:|||.|..:     :|..|    ..:|..::||.:..:..|:..
 Worm    65 SIKKLYENVDTLVGTDGLTVLINNAAICSV-----YEIEGQISRTYMRQQIETNSVSTAILTQNF 124

  Fly   129 FKSLKRRNVNDG-------HILIVNSVAGHRVI-----NNPGITMGMYSPSKYAVTALTEVLRQE 181
            ...||:.:..:|       ...|||..:|...|     ..|||.:. |..||.|:.:.::....|
 Worm   125 IPLLKKASAKNGGEEYSTDRAAIVNISSGAASIGYIDDKQPGIYIA-YRMSKSALNSFSKSCSVE 188

  Fly   182 FHNNKTQTKITSISPGAVDTEI 203
            .  .|....:|::.||.|.|::
 Worm   189 L--AKYHILVTAMCPGWVKTDM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 55/217 (25%)
NADB_Rossmann 1..246 CDD:304358 55/217 (25%)
ZK697.14NP_001024318.1 carb_red_sniffer_like_SDR_c 6..248 CDD:187586 54/215 (25%)
adh_short 6..211 CDD:278532 54/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.