DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and HSD11B1

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens


Alignment Length:221 Identity:64/221 - (28%)
Similarity:101/221 - (45%) Gaps:22/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKA---SLPADQASRFHGRKCDVSQEQEV 71
            :|||||.|||......|...|..||..||.::.||::.:   .|.|..|....|...|::..::.
Human    38 IVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQF 102

  Fly    72 IDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADL---RAILDTNVLGVSWCTREAFKSLK 133
            :   |.....:||.|:|:.| .|....:.:.|:    |:   |..::.|.|.....|..|...||
Human   103 V---AQAGKLMGGLDMLILN-HITNTSLNLFHD----DIHHVRKSMEVNFLSYVVLTVAALPMLK 159

  Fly   134 RRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGA 198
            :.|   |.|::|:|:||.  :..|  .:..||.||:|:......:|:|:..::....||....|.
Human   160 QSN---GSIVVVSSLAGK--VAYP--MVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGL 217

  Fly   199 VDTEIIDKEALVGIPDFPMLRSEDVA 224
            :|||...| |:.||........|:.|
Human   218 IDTETAMK-AVSGIVHMQAAPKEECA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 64/221 (29%)
NADB_Rossmann 1..246 CDD:304358 64/221 (29%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 64/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.