DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG31937

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:227 Identity:57/227 - (25%)
Similarity:96/227 - (42%) Gaps:50/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASR----------FHGR 61
            :|..:||||||||.|....|...|:.:|..|||.::|::::....|  |:|          ....
  Fly    47 QVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLA--AARGLLATKDVLVIQMD 109

  Fly    62 KCDVSQEQ----EVIDAFAWIDATLGGADVLVNNAG--------IVRLGVGITHEGNGADLRAIL 114
            ..|:.:.:    .|::.|..:       ||||||||        .|.:.|.          |.:.
  Fly   110 MLDLDEHKTHLNTVLNHFHRL-------DVLVNNAGRSQRASWTEVEIEVD----------RELF 157

  Fly   115 DTNVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLR 179
            :.:|..|...:|...:....:|...|||...:|:||.    :|......|..:|:|:.|....|:
  Fly   158 ELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGF----SPVPFSPTYCAAKHALNAYLLSLK 218

  Fly   180 QEFHNNKTQTKITSISPGAVDTEIIDKEALVG 211
            .|..    :..::..:||.:.|:.: :||..|
  Fly   219 VEMR----KLDVSLFAPGPIATDFL-QEAFTG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 57/227 (25%)
NADB_Rossmann 1..246 CDD:304358 57/227 (25%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 57/227 (25%)
adh_short 47..245 CDD:278532 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.