DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG31548

DIOPT Version :10

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:76 Identity:18/76 - (23%)
Similarity:33/76 - (43%) Gaps:19/76 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 DTKSLNNYTSIIAVAA-------FPFIDPLAIMVFLPEYRKLFTKIFLPFLYNS-------STVY 324
            :.::.|::..||.|.|       |.....|::|.   :|..:|:.|||..:.::       ..:|
  Fly     3 EVQNRNDWHCIIKVRAMFRRLGTFSITPQLSVMW---KYAVVFSAIFLIHIVDAGFQISQLKPLY 64

  Fly   325 PES--TVRESS 333
            .|.  |:.|.|
  Fly    65 KEDNITISELS 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 Rossmann-fold NAD(P)(+)-binding proteins 1..246 CDD:473865
CG31548NP_730974.1 Rossmann-fold NAD(P)(+)-binding proteins 3..253 CDD:473865 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.