DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and CG13377

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:249 Identity:63/249 - (25%)
Similarity:97/249 - (38%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGL-VVVGLARREDRLQELKASLPADQ--------------- 54
            :||.::|.|.:.:|...|..|.:||. |..|:...:|       ||||..               
  Fly    45 SRVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQD-------SLPAKLLCGWMKIREYSEEPI 102

  Fly    55 ASRFHGRKCDVSQEQEVIDAFAWIDATLG----GADVLVNNAGIVRLGVGITHEGNGADLRAILD 115
            |......:.||::|..:.:|...|.|.|.    |...::|.:|.|..|.  ....|......:|.
  Fly   103 AGTIIPMRLDVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQ--VESQNVQQWEHMLR 165

  Fly   116 TNVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQ 180
            ||:|| :....:||....|  ...|.:|.:..|:|.....|.|..:..::.|:.||....|.||:
  Fly   166 TNILG-TLRVAKAFVCFLR--PTRGRLLYLGGVSGGGNARNEGDGLVAFNASRVAVDKCAEELRK 227

  Fly   181 EFHNNKTQTKITSISPGAVDTEIIDKEALVGIPDFPMLRSEDVADAISYCIQTP 234
            |.|.       ..:|..|:||..:..|:|...|         ||..:|..:..|
  Fly   228 ELHP-------YGVSVVALDTCGMTAESLYKAP---------VAQTMSLVVGAP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 63/249 (25%)
NADB_Rossmann 1..246 CDD:304358 63/249 (25%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 56/218 (26%)
NADB_Rossmann 46..>237 CDD:304358 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.