DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Dhrs7l1

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001013116.1 Gene:Dhrs7l1 / 299131 RGDID:1308036 Length:324 Species:Rattus norvegicus


Alignment Length:252 Identity:68/252 - (26%)
Similarity:106/252 - (42%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKAS--------------LPADQAS 56
            ::|..:||||||||......|...|:.:|..|||...|:.:|..              ||.|.| 
  Rat    49 DKVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLENGNLKEKDILVLPLDLA- 112

  Fly    57 RFHGRKCDVSQE----QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADL-RAILDT 116
                   |.|..    :.|:..|       |..|:||||.|:....:   .|....|: :.:::.
  Rat   113 -------DTSSHDIATKTVLQEF-------GRIDILVNNGGVAHASL---VENTNMDIFKVLIEV 160

  Fly   117 NVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQE 181
            |.||....|:.....:..|  |.|.|:::.|:.|  ::..| :..| |:.||.|:....:|||.|
  Rat   161 NYLGTVSLTKCVLPHMMER--NQGKIVVMKSLVG--IVPRP-LCSG-YAASKLALRGFFDVLRTE 219

  Fly   182 FHNNKTQTKITSISPGAVDTEIIDKEALVG------IPDFPMLRSEDVADAISYCIQ 232
            ..:....| ::.|.||.|.:.|. :.|..|      :|..|:.:.|     .|.|:|
  Rat   220 LFDYPGIT-LSMICPGPVHSNIF-QNAFTGDFTETRLPKIPLFKME-----TSRCVQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 68/252 (27%)
NADB_Rossmann 1..246 CDD:304358 68/252 (27%)
Dhrs7l1NP_001013116.1 11beta-HSD1_like_SDR_c 47..305 CDD:187593 68/252 (27%)
adh_short 50..247 CDD:278532 61/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.