Sequence 1: | NP_572746.1 | Gene: | CG9360 / 32128 | FlyBaseID: | FBgn0030332 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258527.1 | Gene: | Dhrs7c / 287411 | RGDID: | 1306989 | Length: | 311 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 54/203 - (26%) |
---|---|---|---|
Similarity: | 92/203 - (45%) | Gaps: | 30/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLP--ADQASRFHGR------- 61
Fly 62 --KCDVSQEQEVIDAFAWIDATLGGADVLVNNAGI-VRLGVGITHEGNGADLRAILDTNVLGVSW 123
Fly 124 CTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQ 188
Fly 189 TKITSISP 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9360 | NP_572746.1 | YdfG | 1..250 | CDD:226674 | 54/203 (27%) |
NADB_Rossmann | 1..246 | CDD:304358 | 54/203 (27%) | ||
Dhrs7c | NP_001258527.1 | 11beta-HSD1_like_SDR_c | 35..296 | CDD:187593 | 54/203 (27%) |
PRK06181 | 37..293 | CDD:235726 | 54/203 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |