DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and SPAC521.03

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_593098.1 Gene:SPAC521.03 / 2543461 PomBaseID:SPAC521.03 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:72/255 - (28%)
Similarity:115/255 - (45%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDL--VSKGLVVVGLARREDRLQELKASLPADQASRFHGRKC 63
            |.|...:..::||||||||.:...::  |:|..:::. |||...::|:...|.:.........|.
pombe     1 MSRLDGKTILITGASSGIGKSTAFEIAKVAKVKLILA-ARRFSTVEEIAKELESKYEVSVLPLKL 64

  Fly    64 DVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREA 128
            |||..:.:......:.......|||:||||:. ||.....:.|..|...::.|||||:...||..
pombe    65 DVSDLKSIPGVIESLPKEFADIDVLINNAGLA-LGTDKVIDLNIDDAVTMITTNVLGMMAMTRAV 128

  Fly   129 FKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITS 193
            ......:  |.|.||.|.|:||....    :...:|..:|.|:...|..||:|  ...|:.:|..
pombe   129 LPIFYSK--NKGDILNVGSIAGRESY----VGGSVYCSTKSALAQFTSALRKE--TIDTRIRIME 185

  Fly   194 ISPGAVDTEII------DKEALVGI-PDFPMLRSEDVADAISYCIQTPPNVQIHELTIKP 246
            :.||.|:||..      ||:....: .:...|..||:|:.|.:.:....||.|.:..:.|
pombe   186 VDPGLVETEFSVVRFHGDKQKADNVYKNSEPLTPEDIAEVILFALTRRENVVIADTLVFP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 72/255 (28%)
NADB_Rossmann 1..246 CDD:304358 71/253 (28%)
SPAC521.03NP_593098.1 YdfG 1..249 CDD:226674 72/255 (28%)
SDR_c5 7..256 CDD:187604 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.