DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and SPCC162.03

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_588241.1 Gene:SPCC162.03 / 2539382 PomBaseID:SPCC162.03 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:59/194 - (30%)
Similarity:97/194 - (50%) Gaps:18/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQEVIDA 74
            ::||:|.|:|.|..|..:::|..|:..:|..|.:        ..:.|:....|.||:..:.|..|
pombe     9 LITGSSKGLGYALVKVGLAQGYNVIACSRAPDTI--------TIEHSKLLKLKLDVTDVKSVETA 65

  Fly    75 FAWIDATLGGADVLVNNAGIVRLG-VGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRRNVN 138
            |.......|..|:::||||   .| ||.....|..::...::.|..||::.|:||. :|.|.:..
pombe    66 FKDAKRRFGNVDIVINNAG---YGLVGEFESYNIEEMHRQMNVNFWGVAYITKEAL-NLMRESGK 126

  Fly   139 DGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAVDTE 202
            .|.||.::||||:    .|...:.||:.||:||..|::.:.:|...| ....||.:.||.:.||
pombe   127 GGRILQISSVAGY----YPSPCLSMYNASKFAVEGLSQTIMRELDPN-WNIAITIVQPGGMQTE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 59/194 (30%)
NADB_Rossmann 1..246 CDD:304358 59/194 (30%)
SPCC162.03NP_588241.1 17beta-HSD-like_SDR_c 7..248 CDD:187632 59/194 (30%)
PRK08263 9..257 CDD:181334 59/194 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1885
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.