Sequence 1: | NP_572746.1 | Gene: | CG9360 / 32128 | FlyBaseID: | FBgn0030332 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025461.1 | Gene: | Rdh8 / 235033 | MGIID: | 2685028 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 262 | Identity: | 71/262 - (27%) |
---|---|---|---|
Similarity: | 111/262 - (42%) | Gaps: | 47/262 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVVTGASSGIGAACCKDLV---SKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQE 68
Fly 69 QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEG-NGADLRAILDTNVLGVSWCTREAFKSL 132
Fly 133 KRRNVNDGHILIVNSVAGHRVINNPGITMG-MYSPSKYAVTALTEVLRQEFHNNKTQTKITSISP 196
Fly 197 GAVDTEIIDK-EALVGIPDFP--------------------MLRS-----EDVADAISYCIQT-- 233
Fly 234 PP 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9360 | NP_572746.1 | YdfG | 1..250 | CDD:226674 | 71/262 (27%) |
NADB_Rossmann | 1..246 | CDD:304358 | 71/262 (27%) | ||
Rdh8 | NP_001025461.1 | NADB_Rossmann | 6..263 | CDD:304358 | 71/262 (27%) |
adh_short | 6..201 | CDD:278532 | 58/208 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1880 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.930 |