DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Rdh8

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:111/262 - (42%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASSGIGAACCKDLV---SKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQE 68
            |..:::|.|||||......|.   .:...||...|...:.:.|:|:............:.||..:
Mouse     6 RTVLISGCSSGIGLELALQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVVQLDVCND 70

  Fly    69 QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEG-NGADLRAILDTNVLGVSWCTREAFKSL 132
            :.|.|..:.|:.  |..||||||||:..:|   ..|| :.|.::::.:||..|.....:.....:
Mouse    71 ESVTDCLSHIEG--GQVDVLVNNAGVGLVG---PLEGLSLATMQSVFNTNFFGAVRLVKAVLPGM 130

  Fly   133 KRRNVNDGHILIVNSVAGHRVINNPGITMG-MYSPSKYAVTALTEVLRQEFHNNKTQTKITSISP 196
            |||  ..|||::|:||.|.:     |:... :|:.||:|:....|.|..:.  .:....|:.:.|
Mouse   131 KRR--RQGHIVVVSSVMGLQ-----GVMFNDVYAASKFALEGFFESLAIQL--RQFNIFISMVEP 186

  Fly   197 GAVDTEIIDK-EALVGIPDFP--------------------MLRS-----EDVADAISYCIQT-- 233
            |.|.|:...| .|.|...:||                    :.||     .|||..|:..|.|  
Mouse   187 GPVTTDFEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGTTR 251

  Fly   234 PP 235
            ||
Mouse   252 PP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 71/262 (27%)
NADB_Rossmann 1..246 CDD:304358 71/262 (27%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 71/262 (27%)
adh_short 6..201 CDD:278532 58/208 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.