DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:113/274 - (41%) Gaps:55/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGR---KCDVSQ 67
            |.|.|||||:||:|..|.|...:.|..:|...|....|:||...|......:.|..   ..|::.
Mouse    52 NAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLAD 116

  Fly    68 EQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADL-----RAILDTNVLGVSWCTRE 127
            ...:..|.|.|....|..|||:|||       ||::.|..:|.     |.:::.|..|....|:.
Mouse   117 PGTIAAAAAEILQCFGYVDVLINNA-------GISYRGTISDTIVDVDRKVMEINYFGPVALTKA 174

  Fly   128 AFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKIT 192
            ...|:..|  ..|||:.::|:.|.  |:.|  ....||.||:|..|..:.||.|.  .:...|:|
Mouse   175 LLPSMVER--KQGHIVAISSIQGK--ISIP--FRSAYSASKHATQAFFDCLRAEM--EEANIKVT 231

  Fly   193 SISPGAVDTEI--------------IDKEALVGIPDFPMLRS-----EDVADAIS------YCIQ 232
            .||||.:.|.:              :||....|       ||     :||.||:.      ....
Mouse   232 VISPGYIHTNLSVNAVTADGSRYGALDKNTAQG-------RSAAEVAQDVFDAVGKKKKDVLLTD 289

  Fly   233 TPPNVQIHELTIKP 246
            ..|::.::..|:.|
Mouse   290 FVPSMAVYIRTLAP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 76/274 (28%)
NADB_Rossmann 1..246 CDD:304358 75/272 (28%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 76/274 (28%)
PRK06181 52..319 CDD:235726 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.