DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and F28H7.2

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505742.1 Gene:F28H7.2 / 185096 WormBaseID:WBGene00009236 Length:284 Species:Caenorhabditis elegans


Alignment Length:220 Identity:65/220 - (29%)
Similarity:105/220 - (47%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELK-----ASLPADQASRFHG 60
            |.|:.::||::||:|:|||.|..:.|.|:|..|....|..:||:|.|     |.:|........|
 Worm     1 MSRFTDKVAIITGSSNGIGQATARLLASEGAKVTVTGRNAERLEETKNILLGAGVPEGNVLVVVG 65

  Fly    61 RKCDVSQE--QEVIDAFAWIDATL---GGADVLVNNAGIVRLGVGITHEGNGADLRAILDT---- 116
               |::||  ||.:     |.:||   |..|:|||||     |.||......:.:...:||    
 Worm    66 ---DITQESVQENL-----IKSTLDKFGKIDILVNNA-----GAGIPDAQGKSGVNQSIDTYHKT 117

  Fly   117 ---NVLGVSWCTREAFKSLKRRNVNDGHILIVNSV-AGHRV-INNPGITMGMYSPSKYAVTALTE 176
               ||..|...|::|...|.:   ..|.|:.::|: ||... :.:|..::...:..:|..||..:
 Worm   118 FELNVQSVIEMTQKARPHLAK---TQGEIVNISSIGAGPAAQVASPYYSIAKAALDQYTRTAAID 179

  Fly   177 VLRQEFHNNKTQTKITSISPGAVDT 201
            ::.:..       ::.|:|||||.|
 Worm   180 LVPEGI-------RVNSVSPGAVST 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 65/220 (30%)
NADB_Rossmann 1..246 CDD:304358 65/220 (30%)
F28H7.2NP_505742.1 fabG 3..262 CDD:235506 64/218 (29%)
NADB_Rossmann 4..266 CDD:304358 63/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.