DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and F20G2.2

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_506407.1 Gene:F20G2.2 / 184743 WormBaseID:WBGene00008986 Length:249 Species:Caenorhabditis elegans


Alignment Length:261 Identity:70/261 - (26%)
Similarity:113/261 - (43%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKD-LVSKGL-VVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQEVI 72
            ::|||:.|||....|. |..|.: :::...|...:.:|| ::|   :.||.|....|:..::.:.
 Worm     7 LITGANRGIGLGLLKQFLKHKDIQIIIATCRDPSKAEEL-SNL---KDSRLHILPLDIDCDESIS 67

  Fly    73 DAFAWIDATLG--GADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKR- 134
            ..:|.::..:|  |..||:|||||: |...:..|.|...|...|:||.:..:..|:|....||: 
 Worm    68 KLYAEVEKLVGEDGLTVLLNNAGIL-LPYDVEGEKNRKTLIRQLETNSVSTALITQEFLPLLKKA 131

  Fly   135 --RNVNDGH------ILIVNSVAG-----HRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNK 186
              :|..||:      |:.::|.|.     ....|.|.:.   |..||.|:.:..:....:.  .|
 Worm   132 AAKNGGDGYSINRAAIVNISSTAASVEKIDGTFNGPLVA---YRMSKSALNSFAKSCSIDL--AK 191

  Fly   187 TQTKITSISPGAVDTEIIDKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIH------ELTIK 245
            ....:||..||.|.|.:....|        ||..||....:|..|.|..|.. |      :||:.
 Worm   192 YHILVTSFCPGWVKTGMGGANA--------MLEIEDATKTLSDNILTLGNAH-HGAYLNADLTVI 247

  Fly   246 P 246
            |
 Worm   248 P 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 70/261 (27%)
NADB_Rossmann 1..246 CDD:304358 69/259 (27%)
F20G2.2NP_506407.1 carb_red_sniffer_like_SDR_c 7..248 CDD:187586 69/259 (27%)
adh_short 7..208 CDD:278532 57/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.