Sequence 1: | NP_572746.1 | Gene: | CG9360 / 32128 | FlyBaseID: | FBgn0030332 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006497291.1 | Gene: | Hsd11b1 / 15483 | MGIID: | 103562 | Length: | 304 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 62/202 - (30%) |
---|---|---|---|
Similarity: | 95/202 - (47%) | Gaps: | 17/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 VVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKA---SLPADQASRFHGRKCDVS-QEQE 70
Fly 71 VIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRR 135
Fly 136 NVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAVD 200
Fly 201 TEIIDKE 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9360 | NP_572746.1 | YdfG | 1..250 | CDD:226674 | 62/202 (31%) |
NADB_Rossmann | 1..246 | CDD:304358 | 62/202 (31%) | ||
Hsd11b1 | XP_006497291.1 | 11beta-HSD1_like_SDR_c | 44..291 | CDD:187593 | 62/202 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |