DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Hsd11b1

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus


Alignment Length:202 Identity:62/202 - (30%)
Similarity:95/202 - (47%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKA---SLPADQASRFHGRKCDVS-QEQE 70
            :|||||.|||......|...|..||..||.|:.||::.:   .|.|..|....|...|:: .||.
Mouse    50 IVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQF 114

  Fly    71 VIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRR 135
            ::.|    ...:||.|:|:.| .|.:..:.:.|: :...:|.:::.|.|.....:..|...||:.
Mouse   115 IVKA----GKLMGGLDMLILN-HITQTSLSLFHD-DIHSVRRVMEVNFLSYVVMSTAALPMLKQS 173

  Fly   136 NVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAVD 200
            |   |.|.:::|:||.  :..|.|  ..||.||:|:......:|.|.:..|....||....|.:|
Mouse   174 N---GSIAVISSLAGK--MTQPMI--APYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLID 231

  Fly   201 TEIIDKE 207
            ||...||
Mouse   232 TETAMKE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 62/202 (31%)
NADB_Rossmann 1..246 CDD:304358 62/202 (31%)
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 62/202 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.