DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and Rdh1

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_536684.2 Gene:Rdh1 / 107605 MGIID:1195275 Length:317 Species:Mus musculus


Alignment Length:211 Identity:54/211 - (25%)
Similarity:88/211 - (41%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQE 70
            ::...:||..||.|....:.|..:|:.|:.....|...:||:..    .:.|......||::.:.
Mouse    29 DKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNK----TSDRLETVILDVTKTES 89

  Fly    71 VIDAFAWIDATLGGADV--LVNNAGIVRLGVGITHEG-----NGADLRAILDTNVLGVSWCTREA 128
            ::.|..|:...:|...:  |||||||      .|..|     ...|...:||.|:||:...|...
Mouse    90 IVAATQWVKERVGNRGLWGLVNNAGI------STPSGPNEWMKKQDFARVLDVNLLGMIEVTLSM 148

  Fly   129 FKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITS 193
            ...:::..   |.::.|:||.|.......|     |..|||.|.|.::.||:|.  :....|:..
Mouse   149 LPLVRKAR---GRVVNVSSVMGRMSFFGGG-----YCISKYGVEAFSDSLRREL--SYFGVKVAI 203

  Fly   194 ISPGAVDTEIIDKEAL 209
            |.||...|.:...:.|
Mouse   204 IEPGGFKTCVTSSDRL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 54/211 (26%)
NADB_Rossmann 1..246 CDD:304358 54/211 (26%)
Rdh1NP_536684.2 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 54/210 (26%)
adh_short 30..211 CDD:278532 52/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.