DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9360 and hsd11b1l

DIOPT Version :9

Sequence 1:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001090784.1 Gene:hsd11b1l / 100037875 XenbaseID:XB-GENE-5851849 Length:286 Species:Xenopus tropicalis


Alignment Length:242 Identity:68/242 - (28%)
Similarity:99/242 - (40%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKAS-----------LPADQASRFH 59
            |...:|||||:|||..........|..:|..||||..|||:|:.           :.||.||  |
 Frog    32 NTRVLVTGASTGIGEEIAYHYARAGAKLVLTARREHALQEVKSRCLELGAKNVFLVVADMAS--H 94

  Fly    60 GRKCDVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGIT----HEGNGADLRAILDTNVLG 120
            .     ::||.|.:|.    :.|||.|.||.|      .:|.|    .:|:....|.:::.|.|.
 Frog    95 N-----AREQVVAEAL----SALGGLDYLVLN------HIGWTPFKMWDGDVNHTRWLMEVNFLS 144

  Fly   121 VSWCTREAFKSLKRRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNN 185
            .......|...|.:   :.|.|::::|:.....|  |..|  .|:.||:|:......||.|....
 Frog   145 YIHLATAALPYLTQ---SKGSIIVLSSLTAKTPI--PYTT--SYAASKFALEGFFSSLRHELTMQ 202

  Fly   186 KTQTKITSISPGAVDTE-----IIDKEALVGIPDFPMLRSEDVADAI 227
            .....||....|.:||:     |.||..:...|      :.|.|.|:
 Frog   203 NNPVSITLCILGLIDTQSAMEKIKDKITMSAYP------ASDAALAV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9360NP_572746.1 YdfG 1..250 CDD:226674 68/242 (28%)
NADB_Rossmann 1..246 CDD:304358 68/242 (28%)
hsd11b1lNP_001090784.1 11beta-HSD1_like_SDR_c 30..277 CDD:187593 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.