DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15221 and si:dkey-119m7.4

DIOPT Version :9

Sequence 1:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001038399.1 Gene:si:dkey-119m7.4 / 560629 ZFINID:ZDB-GENE-040724-70 Length:413 Species:Danio rerio


Alignment Length:262 Identity:65/262 - (24%)
Similarity:112/262 - (42%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TLNQQGILASAGFLGVVLSSHAMGFLADTWGRATTLRYALCISSVCSIVSAFSVNIWMLIVFRFL 146
            |:|..|  :|....|:::.:...|.|||.:||...:...|.|.::..:.:||:.|.::.::.||:
Zfish   129 TMNNIG--SSIYMFGLLVGAVLFGALADKYGRRIIILIGLAIQAIFGVGAAFAPNFYIYVLLRFV 191

  Fly   147 TGFFISGGQACVFSLCGEFHGTGSRIRHVTLLSGFLCMAMIFAPAMAIGILPLRIETIVLGMHFS 211
            .|..:|......|.|..|:.|...|:....:...|.....|....:|..|              .
Zfish   192 VGTTVSAVIMNAFVLGTEWTGPKKRMLAGVITDYFFGFGYILLAGVAYLI--------------R 242

  Fly   212 SWRVLLLANVSIP-LLALVGISALPETPKYLLVQGRGDESLEVLR-SIFANNSGRDPSEYPVKEV 274
            .||.|.|| :|.| .|.|..:..||::.::|:...:.:|:|:::| :...|....:..:..:.:.
Zfish   243 DWRKLQLA-ISAPSFLFLFYVWVLPKSARWLMANNKHEEALDLIRKAALINGKPLEDDDMELYQS 306

  Fly   275 ALESGGVSLSDVHGFLDAVRL--VWHQTVPLFYRARLWH---------TLNICCIQFIIYFLAQG 328
            ...|..:.....:..||.||.  :..|::.|||   ||.         :|||......|| |.|.
Zfish   307 PKSSEKLQEQRKYTVLDLVRTPRMRKQSLILFY---LWFVNVLVYYGLSLNISDFGMNIY-LTQM 367

  Fly   329 IF 330
            ||
Zfish   368 IF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 65/262 (25%)
MFS 51..488 CDD:119392 65/262 (25%)
si:dkey-119m7.4NP_001038399.1 2A0119 11..413 CDD:273328 65/262 (25%)
MFS 112..>273 CDD:119392 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.