DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15221 and svopb

DIOPT Version :9

Sequence 1:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_021327288.1 Gene:svopb / 555216 ZFINID:ZDB-GENE-070705-359 Length:266 Species:Danio rerio


Alignment Length:247 Identity:53/247 - (21%)
Similarity:103/247 - (41%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VPLFYRARLWHTLNICCIQFIIYFLAQGIFMWFPTILDELGTRNGENTLLCTVLQGFNINSSSED 365
            :|.:.|.    ||.:.||.|...||..|:.: ..|.|.:.|:       .|.|.:    ||:.|.
Zfish    28 IPEYRRT----TLLVWCIWFFSAFLYYGLVL-LTTELFQAGS-------ACGVTE----NSNIEH 76

  Fly   366 EASSCSVEVDTSTYQVMIIIAACFVVIYLIFAYIIDYMGKKNLLMAWMVLTMICLVAL----HYV 426
            :.|.....:....|..::..........|:..::::.:.::..::....|..:|::.|    |.:
Zfish    77 QCSLMCQHLTIDDYLDLLWTTFAEFPGLLVALWMVNRISRRKSMVICFSLFTVCILPLYACTHRI 141

  Fly   427 EQFALVVIALTVVMAIGNCGGLVSTI-AMEFYPTHINAMGMCFIMMVGRLGAVVGSNILGRLLFA 490
            .....:.||.|.:    |.|..::.: ..|.:||...|:|:.....:.|:||:|...|...||.:
Zfish   142 VLTVFIFIARTSI----NAGWQIAYVYTPEVFPTATRAIGIGTSSGMSRVGALVTPFIAQVLLKS 202

  Fly   491 SCDPIFWALLALVVLLCTLG----YFLP--EKARSQQKKPSATAKAIVTATT 536
            |    .:..|::.::...||    :.||  .:.||.|:...::.:...|..|
Zfish   203 S----VYLTLSVYLIFGLLGTAACWALPMETEGRSLQESTQSSMEQKHTEKT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 40/191 (21%)
MFS 51..488 CDD:119392 40/191 (21%)
svopbXP_021327288.1 Sugar_tr <23..236 CDD:331684 50/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.