DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15221 and CG4462

DIOPT Version :9

Sequence 1:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_650849.1 Gene:CG4462 / 42376 FlyBaseID:FBgn0038752 Length:573 Species:Drosophila melanogaster


Alignment Length:293 Identity:50/293 - (17%)
Similarity:102/293 - (34%) Gaps:81/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGYVIDCDREFANMEGGREENLSEKPRPHTFEEAITLTGVG----RFHY-----KLLLICGL-CF 58
            ||....||..:.........::|:. :.:..:|:   ||..    :|:|     .|::...| |.
  Fly    84 PGSEFTCDTSYLTSSSNSSFSISDN-QCYVLDES---TGTSSECEQFNYVSSFDSLIMQFNLVCL 144

  Fly    59 MGVMV------EIMGVSLIMNQMKCDLQPTLNQQGILASAGFLGVVLSSHAMGFLADTWGRATTL 117
            ..:.|      .:.||.:               .|::.:...||:                  :.
  Fly   145 RDIFVAWTQYWHLFGVLV---------------GGVMGTKMMLGI------------------SP 176

  Fly   118 RYALCISSV----CSIVSAFSVNIWMLIVFRFLT----GFFISGGQACVFSLCGEFHGTGSRIRH 174
            |...|:.:|    |.:|:.::.:..:...||.|:    ....:.|||....:....|    ||..
  Fly   177 RSTYCVGAVAQILCGVVTGYARDFSLHCAFRCLSAVCCAIMFTAGQAIFADITAGMH----RIGA 237

  Fly   175 VTLLSGFLCMAMIFAPAMAIGILPLRIETIVLGMHFSSWRVLLLANVSIPLLALVGISA-LPETP 238
            :.|...|..:.:|..|.              |...|:||. |:...::.|.:.|:.:.. .|::|
  Fly   238 IILYDTFWSIGVILLPG--------------LSSFFNSWS-LIYVGITFPTIMLILLLYWTPDSP 287

  Fly   239 KYLLVQGRGDESLEVLRSIFANNSGRDPSEYPV 271
            ::||.......|::.:..|....:..:...:.:
  Fly   288 RWLLRHAADRFSIDNVEQILREGAAINDRSFKI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 45/261 (17%)
MFS 51..488 CDD:119392 39/237 (16%)
CG4462NP_650849.1 2A0119 <126..532 CDD:273328 42/247 (17%)
MFS 149..>284 CDD:119392 31/186 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.