DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15221 and Slc22a5

DIOPT Version :9

Sequence 1:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_062142.1 Gene:Slc22a5 / 29726 RGDID:3702 Length:557 Species:Rattus norvegicus


Alignment Length:461 Identity:103/461 - (22%)
Similarity:163/461 - (35%) Gaps:126/461 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ILASAGFLGVVLSSHAMGFLADTWGRATTLRYALCISSVCSIVSAFSVNIWMLIVFRFLTGFFIS 152
            :..|..|:||::.|...|.|:|.:||...|...:.:.:..|.:..||||..|..|...|.|....
  Rat   144 LTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQLFSVNFEMFTVLFVLVGMGQI 208

  Fly   153 GGQACVFSLCGEFHGTGSRIRHVTLLSGFLCMAMIFAPAMAIGILPLRIETIVLGMHFSSWRVLL 217
            ......|.|..|......||...||   .:|:...|    ...:|||      .......||:||
  Rat   209 SNYVAAFVLGTEILSKSIRIIFATL---GVCIFYAF----GFMVLPL------FAYFIRDWRMLL 260

  Fly   218 LANVSIPLLALVGISA------LPETPKYLLVQGRGDESLEVLR------SIFANNSGRDPSEYP 270
            ||      |.:.|:..      :||:|::|:.|||..|:..::|      .|.|.::..||||  
  Rat   261 LA------LTVPGVLCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGIVAPSTIFDPSE-- 317

  Fly   271 VKEVALESGGVSLSDVHGFLDAVRLVWHQTVPLFYRARLWHTLNICCIQFIIYFLAQGIFMWFPT 335
                 |:.........|...|.||                 |.||..|..:      .|.:|.  
  Rat   318 -----LQDLNSKKPQSHHIYDLVR-----------------TRNIRIITIM------SIILWL-- 352

  Fly   336 ILDELGTRNGENTLLCTVLQGFNINSSSEDEASSCSVEVDT-----STYQVMIIIAACFVVIYLI 395
                            |:..|:            ..:.:||     ..|....::||..|..|::
  Rat   353 ----------------TISVGY------------FGLSLDTPNLHGDIYVNCFLLAAVEVPAYVL 389

  Fly   396 FAYIIDYMGKKNLLMAWMVL--TMICLVALHYVEQFALVVIALTVVMAIGNCG-----GLVSTIA 453
            ...::.::.::..:.|.:.|  :::..:.|...|.|.|    .|.::.:|..|     .:|....
  Rat   390 AWLLLQHLPRRYSISAALFLGGSVLLFIQLVPSELFYL----STALVMVGKFGITSAYSMVYVYT 450

  Fly   454 MEFYPTHINAMGMCFIMMVGRLGAVVG---------SNILGRLLFASCDPIFWALLALVVLLCTL 509
            .|.|||.:..||:.......|||:::.         ...|..:|..|          |.:|...|
  Rat   451 AELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGS----------LTILTAIL 505

  Fly   510 GYFLPE 515
            ..|.||
  Rat   506 TLFFPE 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 95/432 (22%)
MFS 51..488 CDD:119392 95/432 (22%)
Slc22a5NP_062142.1 2A0119 12..520 CDD:273328 103/461 (22%)
MFS 123..510 CDD:119392 101/458 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.