DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15221 and LOC101884074

DIOPT Version :9

Sequence 1:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_017208324.1 Gene:LOC101884074 / 101884074 -ID:- Length:363 Species:Danio rerio


Alignment Length:355 Identity:86/355 - (24%)
Similarity:146/355 - (41%) Gaps:69/355 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LCFMGVMVEIMGVSLIMNQMKCDLQ------PTLNQQGILASAG---FLGVVLSSHAMGFLADTW 111
            |||.......|.:|:      |...      |.|    ...|||   :||:::.:...|.|:|..
Zfish    18 LCFSSAAAPAMRISV------CSAVNIRITIPFL----FCVSAGSVVYLGMMVGAFFWGGLSDKV 72

  Fly   112 GRATTLRYALCISSVCSIVSAFSVNIWMLIVFRFLTGFFISGGQACVFSLCGEFHGTGSRIRHVT 176
            ||...|...:.::...:.:|:|.......:..|.|:||.|.|....|||...||.....|..|::
Zfish    73 GRRQCLLVCMSVNGFFAFLSSFVQGYSTFLFCRMLSGFGIGGAVPIVFSYFAEFLAREKRGEHLS 137

  Fly   177 LLSGFLCMAMIFAPAMAIGILPLRIETIVLG--MHFSSWRVLLLANVSIPLLALVGISALPETPK 239
            .|..|..:..|:|.|||..|:|....:..:|  ..|.||||.::......:.|:|.::.:||:|:
Zfish   138 WLCMFWMVGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCAFPCVSAVVALTFMPESPR 202

  Fly   240 YLLVQGRGDESLEVLRSIFANN---SGRDPSEYPVKEVAL------------ESGGVSL------ 283
            :.|..|:.||:..||:.|...|   .|.....:.|..:.:            ||....|      
Zfish   203 FYLEMGKHDEAWMVLKQIHDTNMRARGEPEKVFTVNRIKIPKQLDELVEMQSESTNPVLKVLFRI 267

  Fly   284 -SDVHGFLDAVRLVWHQTVPLFYRARLW------HTLNICCIQFIIYFLAQGIFMWFPTIL---- 337
             |::||       :|...:      :.|      :|:.:..:.|.:.|...|:.:|||.::    
Zfish   268 KSELHG-------IWLTFL------KCWDYPIKDNTVKLAIVWFSLSFGYYGLSVWFPDVIKHLQ 319

  Fly   338 -DELGTRNGENTLLCTVLQGFNINSSSEDE 366
             ||..:|...:|  ...::.|..|.:.|::
Zfish   320 ADEYASRVKIHT--SEKIEDFTFNFTLENQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 86/355 (24%)
MFS 51..488 CDD:119392 86/355 (24%)
LOC101884074XP_017208324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208328at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.