DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-D and inaF-B

DIOPT Version :10

Sequence 1:NP_001096958.1 Gene:inaF-D / 32126 FlyBaseID:FBgn0260812 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001162726.1 Gene:inaF-B / 8674114 FlyBaseID:FBgn0259918 Length:81 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:40/73 - (54%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLEEKVKLPPTETISRCYQPQQSN---RKVIRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRP 67
            ::|.:.||....|.|.   .|:.::   .|..|:||:.:|:..||...:.|::||:||||..:.|
  Fly     9 ANLADVVKEAKDEEIP---MPKSNDFFESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSRMPP 70

  Fly    68 F-VTKATH 74
            . |.|.||
  Fly    71 LPVFKHTH 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-DNP_001096958.1 InaF-motif 31..64 CDD:464449 14/32 (44%)
inaF-BNP_001162726.1 InaF-motif 34..68 CDD:464449 14/33 (42%)

Return to query results.
Submit another query.