DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-D and zgc:153157

DIOPT Version :9

Sequence 1:NP_001096958.1 Gene:inaF-D / 32126 FlyBaseID:FBgn0260812 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001038855.1 Gene:zgc:153157 / 751674 ZFINID:ZDB-GENE-060825-224 Length:252 Species:Danio rerio


Alignment Length:245 Identity:50/245 - (20%)
Similarity:91/245 - (37%) Gaps:86/245 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QSNRKVIRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRPFVTKATHCDKIVIPEKIAIRLLNSS 92
            ::|:|.:|:.||..|||.||||||:|::||..||.||   ..:.:...|.::....:||   |:|
Zfish    20 KTNKKWVRLATVFAYVLSVSLAAIILAIYYSLIWKPT---SASVSGRSDVLMTTTVMAI---NTS 78

  Fly    93 EVTAEQFYKHILEQYRILSHMQQQRQQLLQRQHLQLQQLEANNRFQEVFATATIIQAHPHPHPHP 157
            .::....                              ..:.||       |:.:           
Zfish    79 NISVSDV------------------------------STKVNN-------TSLV----------- 95

  Fly   158 REPPKKPLLGPYSPQPGNISHAMGGDQLDAETEQGHMPLI------LDTSPPVEVTGMGHLKRKT 216
                        ||:....::.:...|:....::||..|:      :..:.....:...|::||:
Zfish    96 ------------SPKSTQTTYDLSTSQMHWGDKKGHEGLLDIPATKMKRTDQAGTSASTHIQRKS 148

  Fly   217 HRGHYK----HHRAR-----AGGQKKLSIANSMASSTPST---TAGGDAS 254
              |.:.    .|..:     ||...:..:|:...||:..|   ::|.|||
Zfish   149 --GLFSTAEVSHVLKTSVLVAGESSEALLAHGATSSSKQTVYGSSGHDAS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-DNP_001096958.1 InaF-motif 31..64 CDD:291678 18/32 (56%)
zgc:153157NP_001038855.1 InaF-motif 23..56 CDD:291678 18/32 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005668
OrthoInspector 1 1.000 - - oto40524
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34929
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.