DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-D and F32D8.15

DIOPT Version :9

Sequence 1:NP_001096958.1 Gene:inaF-D / 32126 FlyBaseID:FBgn0260812 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001122936.1 Gene:F32D8.15 / 6418737 WormBaseID:WBGene00009325 Length:167 Species:Caenorhabditis elegans


Alignment Length:138 Identity:39/138 - (28%)
Similarity:68/138 - (49%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKHSSLEEKVKLPPTETISRCYQPQQSNRKVIRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRP 67
            |..:.:..:.|.|...:..|....|:.::|.||.:||..|:|.|||.||.||:|||:||||   .
 Worm    35 SYSARMRGRSKQPIYSSDKRAKFTQKDSQKWIRFITVLGYILSVSLPAISLSVYYIYIWDP---G 96

  Fly    68 FVTK--ATHCDKIVIPEKIAIRLLNSSEVTAEQFYKHILEQYRILSHMQQQRQQLLQRQHLQ--L 128
            ::||  |...:|.|        .::.|.:.:::..:.:|.....:.....:.:|:.....||  |
 Worm    97 YITKYPADPINKTV--------TIHKSPILSQKVERDLLPMATTIEQKVAESKQIDLASILQDGL 153

  Fly   129 QQLEANNR 136
            :.:|:..|
 Worm   154 KSMESKER 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-DNP_001096958.1 InaF-motif 31..64 CDD:291678 20/32 (63%)
F32D8.15NP_001122936.1 InaF-motif 63..97 CDD:291678 21/36 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158722
Domainoid 1 1.000 46 1.000 Domainoid score I8215
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005668
OrthoInspector 1 1.000 - - oto20106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34929
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16932
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
77.020

Return to query results.
Submit another query.