DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-D and INAFM1

DIOPT Version :10

Sequence 1:NP_001096958.1 Gene:inaF-D / 32126 FlyBaseID:FBgn0260812 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_848606.3 Gene:INAFM1 / 255783 HGNCID:27406 Length:142 Species:Homo sapiens


Alignment Length:34 Identity:18/34 - (52%)
Similarity:24/34 - (70%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRP 67
            :|:..|..|.|||||||::|::||..||.||..|
Human    28 LRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRSP 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-DNP_001096958.1 InaF-motif 31..64 CDD:464449 15/29 (52%)
INAFM1NP_848606.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
InaF-motif 25..59 CDD:464449 16/30 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..83 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..142
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.