powered by:
Protein Alignment inaF-D and INAFM1
DIOPT Version :9
Sequence 1: | NP_001096958.1 |
Gene: | inaF-D / 32126 |
FlyBaseID: | FBgn0260812 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_848606.3 |
Gene: | INAFM1 / 255783 |
HGNCID: | 27406 |
Length: | 142 |
Species: | Homo sapiens |
Alignment Length: | 34 |
Identity: | 18/34 - (52%) |
Similarity: | 24/34 - (70%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 IRILTVAVYVLCVSLAAIMLSLYYIFIWDPTIRP 67
:|:..|..|.|||||||::|::||..||.||..|
Human 28 LRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRSP 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005668 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm41125 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR34929 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.100 |
|
Return to query results.
Submit another query.